PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012125.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family VOZ
Protein Properties Length: 442aa    MW: 49048 Da    PI: 5.9192
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012125.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ293.32.3e-9025540072217
          VOZ  72 gkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhl 169
                  +k+vgip+cegaa +kspwnaaelfdlsll+getirewlffdkprraf+sgnrkqrslpdysgrgwhesrkqvmke+gg+k+syymdpqp++++ewhl
  CCG012125.2 255 SKNVGIPQCEGAAVMKSPWNAAELFDLSLLDGETIREWLFFDKPRRAFDSGNRKQRSLPDYSGRGWHESRKQVMKELGGQKKSYYMDPQPAGCHEWHL 352
                  69************************************************************************************************ PP

          VOZ 170 yeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                  +eyein++d +alyrlelkl+++kks kgkv kd+ladlqkk+grlta
  CCG012125.2 353 FEYEINNCDLCALYRLELKLANGKKSLKGKVPKDPLADLQKKMGRLTA 400
                  **********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MQKGKKSKCT SRSHHLLMDN AKARLNDLLE RFSNLQAARK EGWNSDVAVL EEQVYQGLRE  60
WKAELDVPSP ANSLLDISLG SFSDDIGRLL QLYEEEDDAT SPLTMQSVLK PEMQPEPNFH  120
NLNSGNLTTF QHEYLVNSHG QGLGFQGFHQ PNSSASGLQN VVVSAPDTTT LLDCQQCTLH  180
EEFDPGLFGG TNDIEERGKN AESNNLQYIS PPPSAFMGPK CALWDCTRPA QGSEWCKDYC  240
SSFHATLALN EGPPSKNVGI PQCEGAAVMK SPWNAAELFD LSLLDGETIR EWLFFDKPRR  300
AFDSGNRKQR SLPDYSGRGW HESRKQVMKE LGGQKKSYYM DPQPAGCHEW HLFEYEINNC  360
DLCALYRLEL KLANGKKSLK GKVPKDPLAD LQKKMGRLTA VVTSGNGPTL EGKERLIEKT  420
DSGDVNCAHD HKTSGTGMGP GP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2131560.0AC213156.1 Populus trichocarpa clone POP076-I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037433.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor VOZ1-like
SwissprotQ9SGQ01e-146VOZ1_ARATH; Transcription factor VOZ1
TrEMBLU5FT450.0U5FT45_POPTR; Uncharacterized protein
STRINGPOPTR_0013s12690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-146vascular plant one zinc finger protein